PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG355600.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 543aa    MW: 60141.7 Da    PI: 5.5481
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG355600.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS431.18.5e-1321725411373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++++++c +av+++d  +++ l+++l +l+s +gdpmqRl ay++e++ arl++s+s lyk+l+++e +   sse +++++l++e++P+
  Pavir.9NG355600.3.p 172 LKQVIIACGKAVAENDVFATELLISELGQLVSVSGDPMQRLGAYMLEGIVARLSSSGSMLYKSLKCKEPT---SSELMSYMHLLYEICPF 258
                          57899****************************************************************9...9**************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                          +kf+++ aN aI ea++ge+ vHiiDf+i qG QW++L+qaLa+Rp+gpp ++iTg+++++s   +   l  +g+rL+++A+++g+pfef
  Pavir.9NG355600.3.p 259 FKFGYMSANGAIAEAIKGENFVHIIDFQIAQGSQWITLIQALAARPGGPPYIKITGIDDSNSAyaRGGGLDIVGRRLHSVAQSCGLPFEF 348
                          ***********************************************************988899999********************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          n+ v  + ++++l +L+++pgE +aVn+++qlh+++desvs+e++rd++++++ks++P+vv++veqe+++n+++F+ r +e+l+yy+a+f
  Pavir.9NG355600.3.p 349 NA-VPAASHEVQLAHLALRPGEIIAVNFAYQLHHVPDESVSMENHRDRIIRMIKSINPRVVTLVEQESNTNTAPFFPRYMETLNYYTAMF 437
                          **.7999*********************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          +s+++ lpr+++ r++ E+++++r+ivn++acegaer+erhe ++kW++r+ +aGF+p+pls+ +++++++llr ++s  yr+ee+ g l
  Pavir.9NG355600.3.p 438 ESIDVALPRDDQRRMSAEQHCVARDIVNLIACEGAERVERHELFGKWKARFAMAGFRPYPLSSVVNNTINTLLRSYNSC-YRLEERGGVL 526
                          *****************************************************************************55.********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          +lgWk+r Lv+ SaW
  Pavir.9NG355600.3.p 527 YLGWKNRVLVVSSAW 541
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.57146523IPR005202Transcription factor GRAS
PfamPF035142.9E-129172541IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MSARDSNRPY EISEDSQMPY YNNSATVEEN DRFHVMQNNL DHHHSSPDDG SQKINSSNTQ  60
IFEAQYCTLE SSSANGVYPA QSSTSSHSIS PLSGSPLSQH DSHSDHTYSS PPSASCLTEV  120
ADLQIKLKEL ENAILGPELD ITSDSPESFL QANVQLRPDN WRQLLGIDAG DLKQVIIACG  180
KAVAENDVFA TELLISELGQ LVSVSGDPMQ RLGAYMLEGI VARLSSSGSM LYKSLKCKEP  240
TSSELMSYMH LLYEICPFFK FGYMSANGAI AEAIKGENFV HIIDFQIAQG SQWITLIQAL  300
AARPGGPPYI KITGIDDSNS AYARGGGLDI VGRRLHSVAQ SCGLPFEFNA VPAASHEVQL  360
AHLALRPGEI IAVNFAYQLH HVPDESVSME NHRDRIIRMI KSINPRVVTL VEQESNTNTA  420
PFFPRYMETL NYYTAMFESI DVALPRDDQR RMSAEQHCVA RDIVNLIACE GAERVERHEL  480
FGKWKARFAM AGFRPYPLSS VVNNTINTLL RSYNSCYRLE ERGGVLYLGW KNRVLVVSSA  540
WC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-601745416374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.216170.0callus| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8587660.0HQ858766.1 Zea mays clone UT1682 GRAS transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983228.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_004983229.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLK4A8460.0K4A846_SETIT; Uncharacterized protein
STRINGSi035052m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein